PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29725.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Dof
Protein Properties Length: 362aa    MW: 39041.1 Da    PI: 7.2744
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29725.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-3978138262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  mrna29725.1-v1.0-hybrid  78 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 138
                              7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.0E-3380136IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2781136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52582136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MESLLVRSME VVVEVEVPVV VTDRSCFMIS QKFIIDHTGM IDDDDDQNSN KGVIMGSTTA  60
VGASRLMEKP GQEQLQQQQQ ALKCPRCDSS NTKFCYYNNY SLSQPRHFCK ACKRYWTRGG  120
TLRNVPVGGG CRKNKRVKRP SSTSAVDNGA SSSASSAPNS GNNSNPNPQI DLASNSNHHH  180
MNPLFYQPDH MGINPFTTSG FDQFSALGLG FGDQRFNPAA TSKQIQDLVA ANSLHSSNHS  240
IFSSTSYSTA PTMASVLASK FINGGFKDVR GNNNQYFQNL LPFEDLQIAG AGNGGGGGEA  300
VKEVKVEDGG QSRMGWSTNH QANTEQMGFS SDPTLYWSSS NLGANNWHDP ANLGSSVSSL  360
I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293840.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLA0A0B0M5Z55e-91A0A0B0M5Z5_G
STRINGVIT_10s0003g00040.t013e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.25e-37Dof family protein